Anti IMPG2 pAb (ATL-HPA015907 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015907-25

Protein Description: interphotoreceptor matrix proteoglycan 2
Gene Name: IMPG2
Alternative Gene Name: IPM200, RP56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035270: 49%, ENSRNOG00000001622: 48%
Entrez Gene ID: 50939
Uniprot ID: Q9BZV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPEEEPLSGPAVPIFADTAAESASLTLPKHISEVPGVDDYSVTKA
• Gene Sequence: FDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPEEEPLSGPAVPIFADTAAESASLTLPKHISEVPGVDDYSVTKA
• Gene ID - Mouse: ENSMUSG00000035270
• Gene ID - Rat: ENSRNOG00000001622
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IMPG2 pAb (ATL-HPA015907 w/enhanced validation) – 2 Found

Ten Berge, Josianne C; van Rosmalen, Joost; Vermeer, Jacolien; Hellström, Cecilia; Lindskog, Cecilia; Nilsson, Peter; Qundos, Ulrika; Rothova, Aniki; Schreurs, Marco W J. Serum Autoantibody Profiling of Patients with Paraneoplastic and Non-Paraneoplastic Autoimmune Retinopathy. Plos One. 11(12):e0167909. 

Mitchell, Benjamin; Coulter, Chloe; Geldenhuys, Werner J; Rhodes, Scott; Salido, Ezequiel M. Interphotoreceptor matrix proteoglycans IMPG1 and IMPG2 proteolyze in the SEA domain and reveal localization mutual dependency. Scientific Reports. 2022;12(1):15535.