Anti HYPM pAb (ATL-HPA003356)

Atlas Antibodies

Catalog No.: ATL-HPA003356-25

Protein Description: huntingtin interacting protein M
Gene Name: HYPM
Alternative Gene Name: CXorf27, HIP17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040456: 47%, ENSRNOG00000021452: 46%
Entrez Gene ID: 25763
Uniprot ID: O75409
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPANIMSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPH
• Gene Sequence: NPANIMSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPH
• Gene ID - Mouse: ENSMUSG00000040456
• Gene ID - Rat: ENSRNOG00000021452
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.