PrEST Antigen ZMYM1 (ATL-APrEST92426)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST92426-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: ZMYM1
Alternative Gene Name: FLJ23151, MYM
Sequence: NSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHL
Interspecies mouse/rat: ENSMUSG00000043872: 67%, ENSRNOG00000013855: 64%
Entrez Gene ID: 79830
Uniprot ID: Q5SVZ6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | NSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHL |
| Gene ID - Mouse | ENSMUSG00000043872 |
| Gene ID - Rat | ENSRNOG00000013855 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen ZMYM1 (ATL-APrEST92426) | |
| Datasheet | PrEST Antigen ZMYM1 (ATL-APrEST92426) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZMYM1 (ATL-APrEST92426) at Atlas Antibodies |
| Documents & Links for PrEST Antigen ZMYM1 (ATL-APrEST92426) | |
| Datasheet | PrEST Antigen ZMYM1 (ATL-APrEST92426) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZMYM1 (ATL-APrEST92426) |