PrEST Antigen ZCWPW2 (ATL-APrEST90891)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST90891-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: ZCWPW2
Alternative Gene Name: ZCW2
Sequence: KLQNWPSWPGILCPDRFKGKYVTYDPDGNVEEYHIEFLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQEACLL
Interspecies mouse/rat: ENSMUSG00000037108: 27%, ENSRNOG00000053820: 72%
Entrez Gene ID: 152098
Uniprot ID: Q504Y3
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | KLQNWPSWPGILCPDRFKGKYVTYDPDGNVEEYHIEFLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQEACLL |
| Gene ID - Mouse | ENSMUSG00000037108 |
| Gene ID - Rat | ENSRNOG00000053820 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen ZCWPW2 (ATL-APrEST90891) | |
| Datasheet | PrEST Antigen ZCWPW2 (ATL-APrEST90891) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZCWPW2 (ATL-APrEST90891) at Atlas Antibodies |
| Documents & Links for PrEST Antigen ZCWPW2 (ATL-APrEST90891) | |
| Datasheet | PrEST Antigen ZCWPW2 (ATL-APrEST90891) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZCWPW2 (ATL-APrEST90891) |