PrEST Antigen ZBTB9 (ATL-APrEST94777)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST94777-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: ZBTB9
Alternative Gene Name: MGC23166, ZNF919
Sequence: DAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQT
Interspecies mouse/rat: ENSMUSG00000079605: 86%, ENSRNOG00000026799: 85%
Entrez Gene ID: 221504
Uniprot ID: Q96C00
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | DAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQT |
| Gene ID - Mouse | ENSMUSG00000079605 |
| Gene ID - Rat | ENSRNOG00000026799 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen ZBTB9 (ATL-APrEST94777) | |
| Datasheet | PrEST Antigen ZBTB9 (ATL-APrEST94777) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB9 (ATL-APrEST94777) at Atlas Antibodies |
| Documents & Links for PrEST Antigen ZBTB9 (ATL-APrEST94777) | |
| Datasheet | PrEST Antigen ZBTB9 (ATL-APrEST94777) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB9 (ATL-APrEST94777) |