PrEST Antigen ZBTB21 (ATL-APrEST90760)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST90760-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: ZBTB21
Alternative Gene Name: KIAA1227, ZNF295
Sequence: PLEPDSPTGLSENPTPATEKLFVPQESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHEQTHN
Interspecies mouse/rat: ENSMUSG00000046962: 97%, ENSRNOG00000001623: 96%
Entrez Gene ID: 49854
Uniprot ID: Q9ULJ3
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | PLEPDSPTGLSENPTPATEKLFVPQESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHEQTHN |
| Gene ID - Mouse | ENSMUSG00000046962 |
| Gene ID - Rat | ENSRNOG00000001623 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen ZBTB21 (ATL-APrEST90760) | |
| Datasheet | PrEST Antigen ZBTB21 (ATL-APrEST90760) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB21 (ATL-APrEST90760) at Atlas Antibodies |
| Documents & Links for PrEST Antigen ZBTB21 (ATL-APrEST90760) | |
| Datasheet | PrEST Antigen ZBTB21 (ATL-APrEST90760) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB21 (ATL-APrEST90760) |