PrEST Antigen VWA5B2 (ATL-APrEST87916)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST87916-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: VWA5B2
Alternative Gene Name: DKFZp761K032, LOC90113
Sequence: LPTVVYSKGLQRGSPAGAWDSDQNGNSKRALGDPATPTEGPRRPPPRPPCRLSMGRRHKLCSPDPGQANNSEGSDHDYL
Interspecies mouse/rat: ENSMUSG00000046613: 53%, ENSRNOG00000001707: 52%
Entrez Gene ID: 90113
Uniprot ID: Q8N398
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | LPTVVYSKGLQRGSPAGAWDSDQNGNSKRALGDPATPTEGPRRPPPRPPCRLSMGRRHKLCSPDPGQANNSEGSDHDYL |
| Gene ID - Mouse | ENSMUSG00000046613 |
| Gene ID - Rat | ENSRNOG00000001707 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen VWA5B2 (ATL-APrEST87916) | |
| Datasheet | PrEST Antigen VWA5B2 (ATL-APrEST87916) Datasheet (External Link) |
| Vendor Page | PrEST Antigen VWA5B2 (ATL-APrEST87916) at Atlas Antibodies |
| Documents & Links for PrEST Antigen VWA5B2 (ATL-APrEST87916) | |
| Datasheet | PrEST Antigen VWA5B2 (ATL-APrEST87916) Datasheet (External Link) |
| Vendor Page | PrEST Antigen VWA5B2 (ATL-APrEST87916) |