PrEST Antigen VRK3 (ATL-APrEST91729)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST91729-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: VRK3
Alternative Gene Name:
Sequence: CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSS
Interspecies mouse/rat: ENSMUSG00000002205: 68%, ENSRNOG00000026517: 73%
Entrez Gene ID: 51231
Uniprot ID: Q8IV63
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSS |
Gene ID - Mouse | ENSMUSG00000002205 |
Gene ID - Rat | ENSRNOG00000026517 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen VRK3 (ATL-APrEST91729) | |
Datasheet | PrEST Antigen VRK3 (ATL-APrEST91729) Datasheet (External Link) |
Vendor Page | PrEST Antigen VRK3 (ATL-APrEST91729) at Atlas Antibodies |
Documents & Links for PrEST Antigen VRK3 (ATL-APrEST91729) | |
Datasheet | PrEST Antigen VRK3 (ATL-APrEST91729) Datasheet (External Link) |
Vendor Page | PrEST Antigen VRK3 (ATL-APrEST91729) |