PrEST Antigen UTP20 (ATL-APrEST91191)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST91191-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: UTP20
Alternative Gene Name: 1A6/DRIM, DRIM
Sequence: FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC
Interspecies mouse/rat: ENSMUSG00000004356: 81%, ENSRNOG00000005823: 81%
Entrez Gene ID: 27340
Uniprot ID: O75691
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC |
| Gene ID - Mouse | ENSMUSG00000004356 |
| Gene ID - Rat | ENSRNOG00000005823 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen UTP20 (ATL-APrEST91191) | |
| Datasheet | PrEST Antigen UTP20 (ATL-APrEST91191) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UTP20 (ATL-APrEST91191) at Atlas Antibodies |
| Documents & Links for PrEST Antigen UTP20 (ATL-APrEST91191) | |
| Datasheet | PrEST Antigen UTP20 (ATL-APrEST91191) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UTP20 (ATL-APrEST91191) |