PrEST Antigen UBA3 (ATL-APrEST88470)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST88470-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: UBA3
Alternative Gene Name: hUba3, NAE2, UBE1C
Sequence: VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLE
Interspecies mouse/rat: ENSMUSG00000030061: 100%, ENSRNOG00000006221: 100%
Entrez Gene ID: 9039
Uniprot ID: Q8TBC4
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLE |
| Gene ID - Mouse | ENSMUSG00000030061 |
| Gene ID - Rat | ENSRNOG00000006221 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen UBA3 (ATL-APrEST88470) | |
| Datasheet | PrEST Antigen UBA3 (ATL-APrEST88470) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UBA3 (ATL-APrEST88470) at Atlas Antibodies |
| Documents & Links for PrEST Antigen UBA3 (ATL-APrEST88470) | |
| Datasheet | PrEST Antigen UBA3 (ATL-APrEST88470) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UBA3 (ATL-APrEST88470) |