PrEST Antigen TMPRSS11E (ATL-APrEST83233)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST83233-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: TMPRSS11E
Alternative Gene Name: DESC1, TMPRSS11E2
Sequence: VLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWP
Interspecies mouse/rat: ENSMUSG00000054537: 75%, ENSRNOG00000022255: 74%
Entrez Gene ID: 28983
Uniprot ID: Q9UL52
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | VLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWP |
Gene ID - Mouse | ENSMUSG00000054537 |
Gene ID - Rat | ENSRNOG00000022255 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen TMPRSS11E (ATL-APrEST83233) | |
Datasheet | PrEST Antigen TMPRSS11E (ATL-APrEST83233) Datasheet (External Link) |
Vendor Page | PrEST Antigen TMPRSS11E (ATL-APrEST83233) at Atlas Antibodies |
Documents & Links for PrEST Antigen TMPRSS11E (ATL-APrEST83233) | |
Datasheet | PrEST Antigen TMPRSS11E (ATL-APrEST83233) Datasheet (External Link) |
Vendor Page | PrEST Antigen TMPRSS11E (ATL-APrEST83233) |