PrEST Antigen TMPRSS11E (ATL-APrEST83233)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST83233-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: TMPRSS11E
Alternative Gene Name: DESC1, TMPRSS11E2
Sequence: VLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWP
Interspecies mouse/rat: ENSMUSG00000054537: 75%, ENSRNOG00000022255: 74%
Entrez Gene ID: 28983
Uniprot ID: Q9UL52
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | VLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWP |
| Gene ID - Mouse | ENSMUSG00000054537 |
| Gene ID - Rat | ENSRNOG00000022255 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen TMPRSS11E (ATL-APrEST83233) | |
| Datasheet | PrEST Antigen TMPRSS11E (ATL-APrEST83233) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TMPRSS11E (ATL-APrEST83233) at Atlas Antibodies |
| Documents & Links for PrEST Antigen TMPRSS11E (ATL-APrEST83233) | |
| Datasheet | PrEST Antigen TMPRSS11E (ATL-APrEST83233) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TMPRSS11E (ATL-APrEST83233) |