PrEST Antigen TMEM8A (ATL-APrEST92480)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST92480-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: TMEM8A
Alternative Gene Name: M83, TMEM6, TMEM8
Sequence: PFLGFNTSLNCTTAFFQGYPLSLSAWSRRANLIIPYPETDNWYLSLQLMCPENAEDCEQAVVHVETTLYLVPC
Interspecies mouse/rat: ENSMUSG00000024180: 81%, ENSRNOG00000020374: 82%
Entrez Gene ID: 58986
Uniprot ID: Q9HCN3
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | PFLGFNTSLNCTTAFFQGYPLSLSAWSRRANLIIPYPETDNWYLSLQLMCPENAEDCEQAVVHVETTLYLVPC |
| Gene ID - Mouse | ENSMUSG00000024180 |
| Gene ID - Rat | ENSRNOG00000020374 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen TMEM8A (ATL-APrEST92480) | |
| Datasheet | PrEST Antigen TMEM8A (ATL-APrEST92480) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TMEM8A (ATL-APrEST92480) at Atlas Antibodies |
| Documents & Links for PrEST Antigen TMEM8A (ATL-APrEST92480) | |
| Datasheet | PrEST Antigen TMEM8A (ATL-APrEST92480) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TMEM8A (ATL-APrEST92480) |