PrEST Antigen TGS1 (ATL-APrEST90698)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST90698-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: TGS1
Alternative Gene Name: NCOA6IP, PIMT
Sequence: KHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEADDKNDEKCMKVDLVSFPSSPIMVD
Interspecies mouse/rat: ENSMUSG00000028233: 72%, ENSRNOG00000008156: 68%
Entrez Gene ID: 96764
Uniprot ID: Q96RS0
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | KHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEADDKNDEKCMKVDLVSFPSSPIMVD |
| Gene ID - Mouse | ENSMUSG00000028233 |
| Gene ID - Rat | ENSRNOG00000008156 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen TGS1 (ATL-APrEST90698) | |
| Datasheet | PrEST Antigen TGS1 (ATL-APrEST90698) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TGS1 (ATL-APrEST90698) at Atlas Antibodies |
| Documents & Links for PrEST Antigen TGS1 (ATL-APrEST90698) | |
| Datasheet | PrEST Antigen TGS1 (ATL-APrEST90698) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TGS1 (ATL-APrEST90698) |