PrEST Antigen TBC1D10A (ATL-APrEST93305)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST93305-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: TBC1D10A
Alternative Gene Name: AC004997.C22.2, EPI64, TBC1D10
Sequence: KPKPPKQAQKEQRKQMKGRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTYL
Interspecies mouse/rat: ENSMUSG00000034412: 65%, ENSRNOG00000006394: 67%
Entrez Gene ID: 83874
Uniprot ID: Q9BXI6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | KPKPPKQAQKEQRKQMKGRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTYL |
| Gene ID - Mouse | ENSMUSG00000034412 |
| Gene ID - Rat | ENSRNOG00000006394 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen TBC1D10A (ATL-APrEST93305) | |
| Datasheet | PrEST Antigen TBC1D10A (ATL-APrEST93305) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TBC1D10A (ATL-APrEST93305) at Atlas Antibodies |
| Documents & Links for PrEST Antigen TBC1D10A (ATL-APrEST93305) | |
| Datasheet | PrEST Antigen TBC1D10A (ATL-APrEST93305) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TBC1D10A (ATL-APrEST93305) |