PrEST Antigen SPTLC1 (ATL-APrEST90057)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST90057-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: SPTLC1
Alternative Gene Name: hLCB1, HSAN1, HSN1, LCB1, SPTI
Sequence: GISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVE
Interspecies mouse/rat: ENSMUSG00000021468: 88%, ENSRNOG00000010882: 86%
Entrez Gene ID: 10558
Uniprot ID: O15269
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | GISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVE |
| Gene ID - Mouse | ENSMUSG00000021468 |
| Gene ID - Rat | ENSRNOG00000010882 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen SPTLC1 (ATL-APrEST90057) | |
| Datasheet | PrEST Antigen SPTLC1 (ATL-APrEST90057) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SPTLC1 (ATL-APrEST90057) at Atlas Antibodies |
| Documents & Links for PrEST Antigen SPTLC1 (ATL-APrEST90057) | |
| Datasheet | PrEST Antigen SPTLC1 (ATL-APrEST90057) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SPTLC1 (ATL-APrEST90057) |