PrEST Antigen SPPL2A (ATL-APrEST92710)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST92710-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: SPPL2A
Alternative Gene Name: IMP3, PSL2
Sequence: KFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ
Interspecies mouse/rat: ENSMUSG00000027366: 79%, ENSRNOG00000011652: 73%
Entrez Gene ID: 84888
Uniprot ID: Q8TCT8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | KFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ |
Gene ID - Mouse | ENSMUSG00000027366 |
Gene ID - Rat | ENSRNOG00000011652 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen SPPL2A (ATL-APrEST92710) | |
Datasheet | PrEST Antigen SPPL2A (ATL-APrEST92710) Datasheet (External Link) |
Vendor Page | PrEST Antigen SPPL2A (ATL-APrEST92710) at Atlas Antibodies |
Documents & Links for PrEST Antigen SPPL2A (ATL-APrEST92710) | |
Datasheet | PrEST Antigen SPPL2A (ATL-APrEST92710) Datasheet (External Link) |
Vendor Page | PrEST Antigen SPPL2A (ATL-APrEST92710) |