PrEST Antigen SPDYA (ATL-APrEST88868)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST88868-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: SPDYA
Alternative Gene Name: Ringo3, SPDY1, SPY1
Sequence: CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS
Interspecies mouse/rat: ENSMUSG00000052525: 97%, ENSRNOG00000004534: 94%
Entrez Gene ID: 245711
Uniprot ID: Q5MJ70
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS |
Gene ID - Mouse | ENSMUSG00000052525 |
Gene ID - Rat | ENSRNOG00000004534 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen SPDYA (ATL-APrEST88868) | |
Datasheet | PrEST Antigen SPDYA (ATL-APrEST88868) Datasheet (External Link) |
Vendor Page | PrEST Antigen SPDYA (ATL-APrEST88868) at Atlas Antibodies |
Documents & Links for PrEST Antigen SPDYA (ATL-APrEST88868) | |
Datasheet | PrEST Antigen SPDYA (ATL-APrEST88868) Datasheet (External Link) |
Vendor Page | PrEST Antigen SPDYA (ATL-APrEST88868) |