PrEST Antigen SLC9A3R2 (ATL-APrEST93968)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST93968-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: SLC9A3R2
Alternative Gene Name: E3KARP, NHERF-2, SIP-1, TKA-1
Sequence: ETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSD
Interspecies mouse/rat: ENSMUSG00000002504: 94%, ENSRNOG00000002997: 90%
Entrez Gene ID: 9351
Uniprot ID: Q15599
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | ETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSD |
| Gene ID - Mouse | ENSMUSG00000002504 |
| Gene ID - Rat | ENSRNOG00000002997 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen SLC9A3R2 (ATL-APrEST93968) | |
| Datasheet | PrEST Antigen SLC9A3R2 (ATL-APrEST93968) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SLC9A3R2 (ATL-APrEST93968) at Atlas Antibodies |
| Documents & Links for PrEST Antigen SLC9A3R2 (ATL-APrEST93968) | |
| Datasheet | PrEST Antigen SLC9A3R2 (ATL-APrEST93968) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SLC9A3R2 (ATL-APrEST93968) |