PrEST Antigen SLC35F3 (ATL-APrEST92166)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST92166-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: SLC35F3
Alternative Gene Name: FLJ37712
Sequence: WDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARP
Interspecies mouse/rat: ENSMUSG00000057060: 80%, ENSRNOG00000049456: 80%
Entrez Gene ID: 148641
Uniprot ID: Q8IY50
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | WDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARP |
Gene ID - Mouse | ENSMUSG00000057060 |
Gene ID - Rat | ENSRNOG00000049456 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen SLC35F3 (ATL-APrEST92166) | |
Datasheet | PrEST Antigen SLC35F3 (ATL-APrEST92166) Datasheet (External Link) |
Vendor Page | PrEST Antigen SLC35F3 (ATL-APrEST92166) at Atlas Antibodies |
Documents & Links for PrEST Antigen SLC35F3 (ATL-APrEST92166) | |
Datasheet | PrEST Antigen SLC35F3 (ATL-APrEST92166) Datasheet (External Link) |
Vendor Page | PrEST Antigen SLC35F3 (ATL-APrEST92166) |