PrEST Antigen SLC10A7 (ATL-APrEST89829)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST89829-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: SLC10A7
Alternative Gene Name: C4orf13, DKFZp313H0531, DKFZp566M114, DKFZp779O2438, MGC25043
Sequence: KSWMVSRQKKLLQTRGPLANLNNPEGLEYLSIKFGH
Interspecies mouse/rat: ENSMUSG00000091318: 33%, ENSRNOG00000031855: 33%
Entrez Gene ID: 84068
Uniprot ID: Q0GE19
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | KSWMVSRQKKLLQTRGPLANLNNPEGLEYLSIKFGH |
| Gene ID - Mouse | ENSMUSG00000091318 |
| Gene ID - Rat | ENSRNOG00000031855 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen SLC10A7 (ATL-APrEST89829) | |
| Datasheet | PrEST Antigen SLC10A7 (ATL-APrEST89829) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SLC10A7 (ATL-APrEST89829) at Atlas Antibodies |
| Documents & Links for PrEST Antigen SLC10A7 (ATL-APrEST89829) | |
| Datasheet | PrEST Antigen SLC10A7 (ATL-APrEST89829) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SLC10A7 (ATL-APrEST89829) |