PrEST Antigen SBK3 (ATL-APrEST94487)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST94487-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: SBK3
Alternative Gene Name: SgK110
Sequence: EDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSY
Interspecies mouse/rat: ENSMUSG00000085272: 85%, ENSRNOG00000042927: 77%
Entrez Gene ID: 100130827
Uniprot ID: P0C264
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | EDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSY |
Gene ID - Mouse | ENSMUSG00000085272 |
Gene ID - Rat | ENSRNOG00000042927 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen SBK3 (ATL-APrEST94487) | |
Datasheet | PrEST Antigen SBK3 (ATL-APrEST94487) Datasheet (External Link) |
Vendor Page | PrEST Antigen SBK3 (ATL-APrEST94487) at Atlas Antibodies |
Documents & Links for PrEST Antigen SBK3 (ATL-APrEST94487) | |
Datasheet | PrEST Antigen SBK3 (ATL-APrEST94487) Datasheet (External Link) |
Vendor Page | PrEST Antigen SBK3 (ATL-APrEST94487) |