PrEST Antigen RRS1 (ATL-APrEST88463)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST88463-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: RRS1
Alternative Gene Name: KIAA0112
Sequence: EELLAKAEQDEAEKLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQLLINQ
Interspecies mouse/rat: ENSMUSG00000061024: 91%, ENSRNOG00000007240: 88%
Entrez Gene ID: 23212
Uniprot ID: Q15050
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | EELLAKAEQDEAEKLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQLLINQ |
| Gene ID - Mouse | ENSMUSG00000061024 |
| Gene ID - Rat | ENSRNOG00000007240 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen RRS1 (ATL-APrEST88463) | |
| Datasheet | PrEST Antigen RRS1 (ATL-APrEST88463) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RRS1 (ATL-APrEST88463) at Atlas Antibodies |
| Documents & Links for PrEST Antigen RRS1 (ATL-APrEST88463) | |
| Datasheet | PrEST Antigen RRS1 (ATL-APrEST88463) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RRS1 (ATL-APrEST88463) |