PrEST Antigen RAB8B (ATL-APrEST90410)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST90410-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: RAB8B
Alternative Gene Name:
Sequence: SSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
Interspecies mouse/rat: ENSMUSG00000036943: 94%, ENSRNOG00000018009: 94%
Entrez Gene ID: 51762
Uniprot ID: Q92930
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | SSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL |
| Gene ID - Mouse | ENSMUSG00000036943 |
| Gene ID - Rat | ENSRNOG00000018009 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen RAB8B (ATL-APrEST90410) | |
| Datasheet | PrEST Antigen RAB8B (ATL-APrEST90410) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RAB8B (ATL-APrEST90410) at Atlas Antibodies |
| Documents & Links for PrEST Antigen RAB8B (ATL-APrEST90410) | |
| Datasheet | PrEST Antigen RAB8B (ATL-APrEST90410) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RAB8B (ATL-APrEST90410) |