PrEST Antigen RAB32 (ATL-APrEST77402)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST77402-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: RAB32
Alternative Gene Name:
Sequence: NKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
Interspecies mouse/rat: ENSMUSG00000019832: 69%, ENSRNOG00000014258: 72%
Entrez Gene ID: 10981
Uniprot ID: Q13637
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | NKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC |
| Gene ID - Mouse | ENSMUSG00000019832 |
| Gene ID - Rat | ENSRNOG00000014258 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen RAB32 (ATL-APrEST77402) | |
| Datasheet | PrEST Antigen RAB32 (ATL-APrEST77402) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RAB32 (ATL-APrEST77402) at Atlas Antibodies |
| Documents & Links for PrEST Antigen RAB32 (ATL-APrEST77402) | |
| Datasheet | PrEST Antigen RAB32 (ATL-APrEST77402) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RAB32 (ATL-APrEST77402) |