PrEST Antigen QRFPR (ATL-APrEST94700)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST94700-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: QRFPR
Alternative Gene Name: GPR103
Sequence: CIVNKTFSPAQRHGNSGITMMRKKAKFSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAEN
Interspecies mouse/rat: ENSMUSG00000058400: 63%, ENSRNOG00000014414: 63%
Entrez Gene ID: 84109
Uniprot ID: Q96P65
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | CIVNKTFSPAQRHGNSGITMMRKKAKFSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAEN |
| Gene ID - Mouse | ENSMUSG00000058400 |
| Gene ID - Rat | ENSRNOG00000014414 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen QRFPR (ATL-APrEST94700) | |
| Datasheet | PrEST Antigen QRFPR (ATL-APrEST94700) Datasheet (External Link) |
| Vendor Page | PrEST Antigen QRFPR (ATL-APrEST94700) at Atlas Antibodies |
| Documents & Links for PrEST Antigen QRFPR (ATL-APrEST94700) | |
| Datasheet | PrEST Antigen QRFPR (ATL-APrEST94700) Datasheet (External Link) |
| Vendor Page | PrEST Antigen QRFPR (ATL-APrEST94700) |