PrEST Antigen PPP2R2B (ATL-APrEST88962)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST88962-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: PPP2R2B
Alternative Gene Name: PR52B, PR55-BETA, SCA12
Sequence: YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNA
Interspecies mouse/rat: ENSMUSG00000041769: 100%, ENSRNOG00000018851: 100%
Entrez Gene ID: 5521
Uniprot ID: Q00005
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNA |
Gene ID - Mouse | ENSMUSG00000041769 |
Gene ID - Rat | ENSRNOG00000018851 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen PPP2R2B (ATL-APrEST88962) | |
Datasheet | PrEST Antigen PPP2R2B (ATL-APrEST88962) Datasheet (External Link) |
Vendor Page | PrEST Antigen PPP2R2B (ATL-APrEST88962) at Atlas Antibodies |
Documents & Links for PrEST Antigen PPP2R2B (ATL-APrEST88962) | |
Datasheet | PrEST Antigen PPP2R2B (ATL-APrEST88962) Datasheet (External Link) |
Vendor Page | PrEST Antigen PPP2R2B (ATL-APrEST88962) |