PrEST Antigen PLCH1 (ATL-APrEST91855)
Atlas Antibodies
- Catalog No.:
 - ATL-APrEST91855-100
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $345.00
    
         
                            Gene Name: PLCH1
Alternative Gene Name: DKFZp434C1372, KIAA1069, MGC117152, PLCeta1, PLCL3
Sequence: ETTKHATNTVYETTCTPISKTKPDDDLSSKAKTAALESNLPGSPNTSRGWLPKSPTKGEDWETLKSCSPASSPDLTLEDVIADPTLCFNSGE
Interspecies mouse/rat: ENSMUSG00000036834: 54%, ENSRNOG00000009955: 54%
Entrez Gene ID: 23007
Uniprot ID: Q4KWH8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | ETTKHATNTVYETTCTPISKTKPDDDLSSKAKTAALESNLPGSPNTSRGWLPKSPTKGEDWETLKSCSPASSPDLTLEDVIADPTLCFNSGE | 
| Gene ID - Mouse | ENSMUSG00000036834 | 
| Gene ID - Rat | ENSRNOG00000009955 | 
| Buffer | PBS and 1M Urea, pH 7.4. | 
| Documents & Links for PrEST Antigen PLCH1 (ATL-APrEST91855) | |
| Datasheet | PrEST Antigen PLCH1 (ATL-APrEST91855) Datasheet (External Link) | 
| Vendor Page | PrEST Antigen PLCH1 (ATL-APrEST91855) at Atlas Antibodies | 
| Documents & Links for PrEST Antigen PLCH1 (ATL-APrEST91855) | |
| Datasheet | PrEST Antigen PLCH1 (ATL-APrEST91855) Datasheet (External Link) | 
| Vendor Page | PrEST Antigen PLCH1 (ATL-APrEST91855) |