PrEST Antigen OTOGL (ATL-APrEST91452)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST91452-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: OTOGL
Alternative Gene Name: C12orf64, FLJ90579
Sequence: CEVGEFTAIDHNFQSDCGCIQYLCEKDDVCVFQEVSVLNPGQSMIKYLEEDFCYTIECLEEKDNHTGFHTLNFTLVNCSKKCDVHQVYTPSPSDY
Interspecies mouse/rat: ENSMUSG00000091455: 81%, ENSRNOG00000030316: 82%
Entrez Gene ID: 283310
Uniprot ID: Q3ZCN5
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | CEVGEFTAIDHNFQSDCGCIQYLCEKDDVCVFQEVSVLNPGQSMIKYLEEDFCYTIECLEEKDNHTGFHTLNFTLVNCSKKCDVHQVYTPSPSDY |
Gene ID - Mouse | ENSMUSG00000091455 |
Gene ID - Rat | ENSRNOG00000030316 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen OTOGL (ATL-APrEST91452) | |
Datasheet | PrEST Antigen OTOGL (ATL-APrEST91452) Datasheet (External Link) |
Vendor Page | PrEST Antigen OTOGL (ATL-APrEST91452) at Atlas Antibodies |
Documents & Links for PrEST Antigen OTOGL (ATL-APrEST91452) | |
Datasheet | PrEST Antigen OTOGL (ATL-APrEST91452) Datasheet (External Link) |
Vendor Page | PrEST Antigen OTOGL (ATL-APrEST91452) |