PrEST Antigen OPTC (ATL-APrEST89327)
Atlas Antibodies
- SKU:
- ATL-APrEST89327-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: OPTC
Alternative Gene Name:
Sequence: LPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISP
Interspecies mouse/rat: ENSMUSG00000010311: 50%, ENSRNOG00000003059: 46%
Entrez Gene ID: 26254
Uniprot ID: Q9UBM4
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | LPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISP |
Gene ID - Mouse | ENSMUSG00000010311 |
Gene ID - Rat | ENSRNOG00000003059 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen OPTC (ATL-APrEST89327) | |
Datasheet | PrEST Antigen OPTC (ATL-APrEST89327) Datasheet (External Link) |
Vendor Page | PrEST Antigen OPTC (ATL-APrEST89327) at Atlas Antibodies |
Documents & Links for PrEST Antigen OPTC (ATL-APrEST89327) | |
Datasheet | PrEST Antigen OPTC (ATL-APrEST89327) Datasheet (External Link) |
Vendor Page | PrEST Antigen OPTC (ATL-APrEST89327) |