PrEST Antigen NOTUM (ATL-APrEST94563)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST94563-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: NOTUM
Alternative Gene Name:
Sequence: ANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFL
Interspecies mouse/rat: ENSMUSG00000042988: 93%, ENSRNOG00000036680: 93%
Entrez Gene ID: 147111
Uniprot ID: Q6P988
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | ANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFL |
| Gene ID - Mouse | ENSMUSG00000042988 |
| Gene ID - Rat | ENSRNOG00000036680 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen NOTUM (ATL-APrEST94563) | |
| Datasheet | PrEST Antigen NOTUM (ATL-APrEST94563) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NOTUM (ATL-APrEST94563) at Atlas Antibodies |
| Documents & Links for PrEST Antigen NOTUM (ATL-APrEST94563) | |
| Datasheet | PrEST Antigen NOTUM (ATL-APrEST94563) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NOTUM (ATL-APrEST94563) |