PrEST Antigen NECAB3 (ATL-APrEST94333)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST94333-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: NECAB3
Alternative Gene Name: APBA2BP, dJ63M2.4, dJ63M2.5, EFCBP3, NIP1, SYTIP2, XB51
Sequence: SSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAK
Interspecies mouse/rat: ENSMUSG00000027489: 48%, ENSRNOG00000016708: 48%
Entrez Gene ID: 63941
Uniprot ID: Q96P71
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | SSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAK |
| Gene ID - Mouse | ENSMUSG00000027489 |
| Gene ID - Rat | ENSRNOG00000016708 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen NECAB3 (ATL-APrEST94333) | |
| Datasheet | PrEST Antigen NECAB3 (ATL-APrEST94333) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NECAB3 (ATL-APrEST94333) at Atlas Antibodies |
| Documents & Links for PrEST Antigen NECAB3 (ATL-APrEST94333) | |
| Datasheet | PrEST Antigen NECAB3 (ATL-APrEST94333) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NECAB3 (ATL-APrEST94333) |