PrEST Antigen NCAPD3 (ATL-APrEST90903)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST90903-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: NCAPD3
Alternative Gene Name: CAP-D3, FLJ42888, hCAP-D3, hcp-6, hHCP-6, KIAA0056
Sequence: AFHIWSKKEKFSPTFINNVISHTGTEHSAPAWMLLSKIAGSSPRLDYSRIIQSWEKISSQQNPNSNTLGHILCVIGHIAKHLPKSTRDKVTDAVKCK
Interspecies mouse/rat: ENSMUSG00000035024: 75%, ENSRNOG00000008932: 75%
Entrez Gene ID: 23310
Uniprot ID: P42695
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | AFHIWSKKEKFSPTFINNVISHTGTEHSAPAWMLLSKIAGSSPRLDYSRIIQSWEKISSQQNPNSNTLGHILCVIGHIAKHLPKSTRDKVTDAVKCK |
| Gene ID - Mouse | ENSMUSG00000035024 |
| Gene ID - Rat | ENSRNOG00000008932 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen NCAPD3 (ATL-APrEST90903) | |
| Datasheet | PrEST Antigen NCAPD3 (ATL-APrEST90903) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NCAPD3 (ATL-APrEST90903) at Atlas Antibodies |
| Documents & Links for PrEST Antigen NCAPD3 (ATL-APrEST90903) | |
| Datasheet | PrEST Antigen NCAPD3 (ATL-APrEST90903) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NCAPD3 (ATL-APrEST90903) |