PrEST Antigen NADK2 (ATL-APrEST88714)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST88714-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: NADK2
Alternative Gene Name: C5orf33, FLJ30596, MNADK, NADKD1
Sequence: RELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFNDGAIASMMINKEDELRTVLLE
Interspecies mouse/rat: ENSMUSG00000111527: 97%, ENSRNOG00000054157: 98%
Entrez Gene ID: 133686
Uniprot ID: Q4G0N4
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | RELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFNDGAIASMMINKEDELRTVLLE |
| Gene ID - Mouse | ENSMUSG00000111527 |
| Gene ID - Rat | ENSRNOG00000054157 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen NADK2 (ATL-APrEST88714) | |
| Datasheet | PrEST Antigen NADK2 (ATL-APrEST88714) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NADK2 (ATL-APrEST88714) at Atlas Antibodies |
| Documents & Links for PrEST Antigen NADK2 (ATL-APrEST88714) | |
| Datasheet | PrEST Antigen NADK2 (ATL-APrEST88714) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NADK2 (ATL-APrEST88714) |