PrEST Antigen MCTP2 (ATL-APrEST90304)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST90304-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: MCTP2
Alternative Gene Name: FLJ11175, FLJ33303
Sequence: RHRWSNRKRLSASKSSLIRNLRLSESLKKNQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQW
Interspecies mouse/rat: ENSMUSG00000032776: 96%, ENSRNOG00000009932: 94%
Entrez Gene ID: 55784
Uniprot ID: Q6DN12
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | RHRWSNRKRLSASKSSLIRNLRLSESLKKNQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQW |
| Gene ID - Mouse | ENSMUSG00000032776 |
| Gene ID - Rat | ENSRNOG00000009932 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen MCTP2 (ATL-APrEST90304) | |
| Datasheet | PrEST Antigen MCTP2 (ATL-APrEST90304) Datasheet (External Link) |
| Vendor Page | PrEST Antigen MCTP2 (ATL-APrEST90304) at Atlas Antibodies |
| Documents & Links for PrEST Antigen MCTP2 (ATL-APrEST90304) | |
| Datasheet | PrEST Antigen MCTP2 (ATL-APrEST90304) Datasheet (External Link) |
| Vendor Page | PrEST Antigen MCTP2 (ATL-APrEST90304) |