PrEST Antigen LLPH (ATL-APrEST89863)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST89863-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: LLPH
Alternative Gene Name: C12orf31, hLLP, MGC14817
Sequence: RSKWKRKMRAEKRKKNAPKEASRLKSILKLDGDVLMKDVQEIATVVVPKPK
Interspecies mouse/rat: ENSMUSG00000020224: 82%, ENSRNOG00000004316: 84%
Entrez Gene ID: 84298
Uniprot ID: Q9BRT6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | RSKWKRKMRAEKRKKNAPKEASRLKSILKLDGDVLMKDVQEIATVVVPKPK |
| Gene ID - Mouse | ENSMUSG00000020224 |
| Gene ID - Rat | ENSRNOG00000004316 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen LLPH (ATL-APrEST89863) | |
| Datasheet | PrEST Antigen LLPH (ATL-APrEST89863) Datasheet (External Link) |
| Vendor Page | PrEST Antigen LLPH (ATL-APrEST89863) at Atlas Antibodies |
| Documents & Links for PrEST Antigen LLPH (ATL-APrEST89863) | |
| Datasheet | PrEST Antigen LLPH (ATL-APrEST89863) Datasheet (External Link) |
| Vendor Page | PrEST Antigen LLPH (ATL-APrEST89863) |