PrEST Antigen KIAA0232 (ATL-APrEST88815)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST88815-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: KIAA0232
Alternative Gene Name:
Sequence: ESVHGLCISNNNLHKTYLAAGTFIDGHFVEMPAVINEDIDLTGTSLCSLPEDNKYLDDIHLSELTHFYEVDIDQSMLDPGASETMQGESRILNMI
Interspecies mouse/rat: ENSMUSG00000029190: 94%, ENSRNOG00000027623: 94%
Entrez Gene ID: 9778
Uniprot ID: Q92628
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | ESVHGLCISNNNLHKTYLAAGTFIDGHFVEMPAVINEDIDLTGTSLCSLPEDNKYLDDIHLSELTHFYEVDIDQSMLDPGASETMQGESRILNMI |
| Gene ID - Mouse | ENSMUSG00000029190 |
| Gene ID - Rat | ENSRNOG00000027623 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen KIAA0232 (ATL-APrEST88815) | |
| Datasheet | PrEST Antigen KIAA0232 (ATL-APrEST88815) Datasheet (External Link) |
| Vendor Page | PrEST Antigen KIAA0232 (ATL-APrEST88815) at Atlas Antibodies |
| Documents & Links for PrEST Antigen KIAA0232 (ATL-APrEST88815) | |
| Datasheet | PrEST Antigen KIAA0232 (ATL-APrEST88815) Datasheet (External Link) |
| Vendor Page | PrEST Antigen KIAA0232 (ATL-APrEST88815) |