PrEST Antigen INMT (ATL-APrEST92135)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST92135-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: INMT
Alternative Gene Name:
Sequence: RVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLL
Interspecies mouse/rat: ENSMUSG00000003477: 67%, ENSRNOG00000011250: 67%
Entrez Gene ID: 11185
Uniprot ID: O95050
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | RVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLL |
| Gene ID - Mouse | ENSMUSG00000003477 |
| Gene ID - Rat | ENSRNOG00000011250 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen INMT (ATL-APrEST92135) | |
| Datasheet | PrEST Antigen INMT (ATL-APrEST92135) Datasheet (External Link) |
| Vendor Page | PrEST Antigen INMT (ATL-APrEST92135) at Atlas Antibodies |
| Documents & Links for PrEST Antigen INMT (ATL-APrEST92135) | |
| Datasheet | PrEST Antigen INMT (ATL-APrEST92135) Datasheet (External Link) |
| Vendor Page | PrEST Antigen INMT (ATL-APrEST92135) |