PrEST Antigen IL27RA (ATL-APrEST95172)
Atlas Antibodies
- SKU:
- ATL-APrEST95172-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: IL27RA
Alternative Gene Name: CRL1, IL-27R, TCCR, WSX-1, WSX1, zcytor1
Sequence: QCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNL
Interspecies mouse/rat: ENSMUSG00000005465: 65%, ENSRNOG00000005747: 65%
Entrez Gene ID: 9466
Uniprot ID: Q6UWB1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | QCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNL |
Gene ID - Mouse | ENSMUSG00000005465 |
Gene ID - Rat | ENSRNOG00000005747 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen IL27RA (ATL-APrEST95172) | |
Datasheet | PrEST Antigen IL27RA (ATL-APrEST95172) Datasheet (External Link) |
Vendor Page | PrEST Antigen IL27RA (ATL-APrEST95172) at Atlas Antibodies |
Documents & Links for PrEST Antigen IL27RA (ATL-APrEST95172) | |
Datasheet | PrEST Antigen IL27RA (ATL-APrEST95172) Datasheet (External Link) |
Vendor Page | PrEST Antigen IL27RA (ATL-APrEST95172) |