PrEST Antigen IDH3B (ATL-APrEST89718)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST89718-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: IDH3B
Alternative Gene Name: RP46
Sequence: TAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS
Interspecies mouse/rat: ENSMUSG00000027406: 90%, ENSRNOG00000007316: 94%
Entrez Gene ID: 3420
Uniprot ID: O43837
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | TAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS |
Gene ID - Mouse | ENSMUSG00000027406 |
Gene ID - Rat | ENSRNOG00000007316 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen IDH3B (ATL-APrEST89718) | |
Datasheet | PrEST Antigen IDH3B (ATL-APrEST89718) Datasheet (External Link) |
Vendor Page | PrEST Antigen IDH3B (ATL-APrEST89718) at Atlas Antibodies |
Documents & Links for PrEST Antigen IDH3B (ATL-APrEST89718) | |
Datasheet | PrEST Antigen IDH3B (ATL-APrEST89718) Datasheet (External Link) |
Vendor Page | PrEST Antigen IDH3B (ATL-APrEST89718) |