PrEST Antigen GSTP1 (ATL-APrEST74590)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST74590-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: GSTP1
Alternative Gene Name: FAEES3, GST3, GSTP
Sequence: KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Interspecies mouse/rat: ENSMUSG00000097830: 89%, ENSRNOG00000018237: 83%
Entrez Gene ID: 2950
Uniprot ID: P09211
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
| Gene ID - Mouse | ENSMUSG00000097830 |
| Gene ID - Rat | ENSRNOG00000018237 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen GSTP1 (ATL-APrEST74590) | |
| Datasheet | PrEST Antigen GSTP1 (ATL-APrEST74590) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GSTP1 (ATL-APrEST74590) at Atlas Antibodies |
| Documents & Links for PrEST Antigen GSTP1 (ATL-APrEST74590) | |
| Datasheet | PrEST Antigen GSTP1 (ATL-APrEST74590) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GSTP1 (ATL-APrEST74590) |