PrEST Antigen GMEB2 (ATL-APrEST92728)
Atlas Antibodies
- SKU:
- ATL-APrEST92728-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: GMEB2
Alternative Gene Name: KIAA1269, P79PIF, PIF79
Sequence: ASHKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVSLPPPVKRPRLARATSGPAAMASQVLTQSAQ
Interspecies mouse/rat: ENSMUSG00000038705: 96%, ENSRNOG00000013339: 98%
Entrez Gene ID: 26205
Uniprot ID: Q9UKD1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | ASHKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVSLPPPVKRPRLARATSGPAAMASQVLTQSAQ |
Gene ID - Mouse | ENSMUSG00000038705 |
Gene ID - Rat | ENSRNOG00000013339 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen GMEB2 (ATL-APrEST92728) | |
Datasheet | PrEST Antigen GMEB2 (ATL-APrEST92728) Datasheet (External Link) |
Vendor Page | PrEST Antigen GMEB2 (ATL-APrEST92728) at Atlas Antibodies |
Documents & Links for PrEST Antigen GMEB2 (ATL-APrEST92728) | |
Datasheet | PrEST Antigen GMEB2 (ATL-APrEST92728) Datasheet (External Link) |
Vendor Page | PrEST Antigen GMEB2 (ATL-APrEST92728) |