PrEST Antigen GLTP (ATL-APrEST94916)
Atlas Antibodies
- SKU:
- ATL-APrEST94916-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: GLTP
Alternative Gene Name:
Sequence: RGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYA
Interspecies mouse/rat: ENSMUSG00000011884: 95%, ENSRNOG00000001192: 95%
Entrez Gene ID: 51228
Uniprot ID: Q9NZD2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | RGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYA |
Gene ID - Mouse | ENSMUSG00000011884 |
Gene ID - Rat | ENSRNOG00000001192 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen GLTP (ATL-APrEST94916) | |
Datasheet | PrEST Antigen GLTP (ATL-APrEST94916) Datasheet (External Link) |
Vendor Page | PrEST Antigen GLTP (ATL-APrEST94916) at Atlas Antibodies |
Documents & Links for PrEST Antigen GLTP (ATL-APrEST94916) | |
Datasheet | PrEST Antigen GLTP (ATL-APrEST94916) Datasheet (External Link) |
Vendor Page | PrEST Antigen GLTP (ATL-APrEST94916) |