PrEST Antigen GINS3 (ATL-APrEST91134)
Atlas Antibodies
- SKU:
- ATL-APrEST91134-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: GINS3
Alternative Gene Name: FLJ13912, PSF3
Sequence: PLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLL
Interspecies mouse/rat: ENSMUSG00000031669: 96%, ENSRNOG00000011863: 96%
Entrez Gene ID: 64785
Uniprot ID: Q9BRX5
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | PLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLL |
Gene ID - Mouse | ENSMUSG00000031669 |
Gene ID - Rat | ENSRNOG00000011863 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen GINS3 (ATL-APrEST91134) | |
Datasheet | PrEST Antigen GINS3 (ATL-APrEST91134) Datasheet (External Link) |
Vendor Page | PrEST Antigen GINS3 (ATL-APrEST91134) at Atlas Antibodies |
Documents & Links for PrEST Antigen GINS3 (ATL-APrEST91134) | |
Datasheet | PrEST Antigen GINS3 (ATL-APrEST91134) Datasheet (External Link) |
Vendor Page | PrEST Antigen GINS3 (ATL-APrEST91134) |