PrEST Antigen GHR (ATL-APrEST91025)
Atlas Antibodies
- Catalog No.:
 - ATL-APrEST91025-100
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $345.00
    
         
                            Gene Name: GHR
Alternative Gene Name: GHBP
Sequence: NWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQF
Interspecies mouse/rat: ENSMUSG00000055737: 66%, ENSRNOG00000015654: 68%
Entrez Gene ID: 2690
Uniprot ID: P10912
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | NWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQF | 
| Gene ID - Mouse | ENSMUSG00000055737 | 
| Gene ID - Rat | ENSRNOG00000015654 | 
| Buffer | PBS and 1M Urea, pH 7.4. | 
| Documents & Links for PrEST Antigen GHR (ATL-APrEST91025) | |
| Datasheet | PrEST Antigen GHR (ATL-APrEST91025) Datasheet (External Link) | 
| Vendor Page | PrEST Antigen GHR (ATL-APrEST91025) at Atlas Antibodies | 
| Documents & Links for PrEST Antigen GHR (ATL-APrEST91025) | |
| Datasheet | PrEST Antigen GHR (ATL-APrEST91025) Datasheet (External Link) | 
| Vendor Page | PrEST Antigen GHR (ATL-APrEST91025) |