PrEST Antigen GHR (ATL-APrEST91025)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST91025-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: GHR
Alternative Gene Name: GHBP
Sequence: NWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQF
Interspecies mouse/rat: ENSMUSG00000055737: 66%, ENSRNOG00000015654: 68%
Entrez Gene ID: 2690
Uniprot ID: P10912
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | NWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQF |
| Gene ID - Mouse | ENSMUSG00000055737 |
| Gene ID - Rat | ENSRNOG00000015654 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen GHR (ATL-APrEST91025) | |
| Datasheet | PrEST Antigen GHR (ATL-APrEST91025) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GHR (ATL-APrEST91025) at Atlas Antibodies |
| Documents & Links for PrEST Antigen GHR (ATL-APrEST91025) | |
| Datasheet | PrEST Antigen GHR (ATL-APrEST91025) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GHR (ATL-APrEST91025) |