PrEST Antigen GGH (ATL-APrEST74642)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST74642-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: GGH
Alternative Gene Name:
Sequence: FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKK
Interspecies mouse/rat: ENSMUSG00000073987: 77%, ENSRNOG00000007351: 73%
Entrez Gene ID: 8836
Uniprot ID: Q92820
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKK |
| Gene ID - Mouse | ENSMUSG00000073987 |
| Gene ID - Rat | ENSRNOG00000007351 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen GGH (ATL-APrEST74642) | |
| Datasheet | PrEST Antigen GGH (ATL-APrEST74642) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GGH (ATL-APrEST74642) at Atlas Antibodies |
| Documents & Links for PrEST Antigen GGH (ATL-APrEST74642) | |
| Datasheet | PrEST Antigen GGH (ATL-APrEST74642) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GGH (ATL-APrEST74642) |