PrEST Antigen GEMIN2 (ATL-APrEST89797)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST89797-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: GEMIN2
Alternative Gene Name: SIP1
Sequence: ARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
Interspecies mouse/rat: ENSMUSG00000060121: 98%, ENSRNOG00000004360: 98%
Entrez Gene ID: 8487
Uniprot ID: O14893
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | ARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS |
| Gene ID - Mouse | ENSMUSG00000060121 |
| Gene ID - Rat | ENSRNOG00000004360 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen GEMIN2 (ATL-APrEST89797) | |
| Datasheet | PrEST Antigen GEMIN2 (ATL-APrEST89797) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GEMIN2 (ATL-APrEST89797) at Atlas Antibodies |
| Documents & Links for PrEST Antigen GEMIN2 (ATL-APrEST89797) | |
| Datasheet | PrEST Antigen GEMIN2 (ATL-APrEST89797) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GEMIN2 (ATL-APrEST89797) |