PrEST Antigen GCAT (ATL-APrEST94878)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST94878-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: GCAT
Alternative Gene Name: KBL
Sequence: RGAGTWKSERVITSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQ
Interspecies mouse/rat: ENSMUSG00000116378: 93%, ENSRNOG00000055408: 94%
Entrez Gene ID: 23464
Uniprot ID: O75600
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | RGAGTWKSERVITSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQ |
| Gene ID - Mouse | ENSMUSG00000116378 |
| Gene ID - Rat | ENSRNOG00000055408 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen GCAT (ATL-APrEST94878) | |
| Datasheet | PrEST Antigen GCAT (ATL-APrEST94878) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GCAT (ATL-APrEST94878) at Atlas Antibodies |
| Documents & Links for PrEST Antigen GCAT (ATL-APrEST94878) | |
| Datasheet | PrEST Antigen GCAT (ATL-APrEST94878) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GCAT (ATL-APrEST94878) |