PrEST Antigen GAS6 (ATL-APrEST91705)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST91705-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: GAS6
Alternative Gene Name: AXLLG, AXSF, DKFZp666G247, FLJ34709
Sequence: DCINKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQEN
Interspecies mouse/rat: ENSMUSG00000031451: 76%, ENSRNOG00000018233: 82%
Entrez Gene ID: 2621
Uniprot ID: Q14393
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | DCINKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQEN |
| Gene ID - Mouse | ENSMUSG00000031451 |
| Gene ID - Rat | ENSRNOG00000018233 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen GAS6 (ATL-APrEST91705) | |
| Datasheet | PrEST Antigen GAS6 (ATL-APrEST91705) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GAS6 (ATL-APrEST91705) at Atlas Antibodies |
| Documents & Links for PrEST Antigen GAS6 (ATL-APrEST91705) | |
| Datasheet | PrEST Antigen GAS6 (ATL-APrEST91705) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GAS6 (ATL-APrEST91705) |