PrEST Antigen GALR1 (ATL-APrEST95245)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST95245-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: GALR1
Alternative Gene Name: GALNR, GALNR1
Sequence: MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVT
Interspecies mouse/rat: ENSMUSG00000024553: 81%, ENSRNOG00000016654: 81%
Entrez Gene ID: 2587
Uniprot ID: P47211
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVT |
Gene ID - Mouse | ENSMUSG00000024553 |
Gene ID - Rat | ENSRNOG00000016654 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen GALR1 (ATL-APrEST95245) | |
Datasheet | PrEST Antigen GALR1 (ATL-APrEST95245) Datasheet (External Link) |
Vendor Page | PrEST Antigen GALR1 (ATL-APrEST95245) at Atlas Antibodies |
Documents & Links for PrEST Antigen GALR1 (ATL-APrEST95245) | |
Datasheet | PrEST Antigen GALR1 (ATL-APrEST95245) Datasheet (External Link) |
Vendor Page | PrEST Antigen GALR1 (ATL-APrEST95245) |