PrEST Antigen GAB1 (ATL-APrEST91203)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST91203-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: GAB1
Alternative Gene Name:
Sequence: TSKLDTIPDIPPPRPPKPHPAHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFP
Interspecies mouse/rat: ENSMUSG00000031714: 90%, ENSRNOG00000017879: 88%
Entrez Gene ID: 2549
Uniprot ID: Q13480
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | TSKLDTIPDIPPPRPPKPHPAHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFP |
| Gene ID - Mouse | ENSMUSG00000031714 |
| Gene ID - Rat | ENSRNOG00000017879 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen GAB1 (ATL-APrEST91203) | |
| Datasheet | PrEST Antigen GAB1 (ATL-APrEST91203) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GAB1 (ATL-APrEST91203) at Atlas Antibodies |
| Documents & Links for PrEST Antigen GAB1 (ATL-APrEST91203) | |
| Datasheet | PrEST Antigen GAB1 (ATL-APrEST91203) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GAB1 (ATL-APrEST91203) |